Xanthomonas cucurbitae: EBN15_04425 Help Entry EBN15_04425       CDS       T06553                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xcz  Xanthomonas cucurbitae Pathway xcz01100   Metabolic pathways xcz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xcz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EBN15_04425    00074 Mycolic acid biosynthesis     EBN15_04425   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EBN15_04425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Motif Other DBs NCBI-ProteinID:  QHG86346 LinkDB All DBs Position 1014756..1014995 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacaactcggcgtcaaggaa gaggaagtcaccaccagtgcatcgttcgtcgatgatctgggtgccgactcactggacacc gtcgagctggtgatggcgctggaagaagagttcgagtgcgagatcccggacgaagaggcc gagaagatcacctcggtccagcaggcgatcgactacgtcaaggctcacgtcaagagctga

DBGET integrated database retrieval system