Xanthomonas cucurbitae: EBN15_07455 Help Entry EBN15_07455       CDS       T06553                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism xcz  Xanthomonas cucurbitae Pathway xcz02024   Quorum sensing xcz03018   RNA degradation Brite KEGG Orthology (KO) [BR:xcz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     EBN15_07455  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     EBN15_07455  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:xcz03019]     EBN15_07455    03036 Chromosome and associated proteins [BR:xcz03036]     EBN15_07455 Messenger RNA biogenesis [BR:xcz03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      EBN15_07455 Chromosome and associated proteins [BR:xcz03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     EBN15_07455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QHG86857 LinkDB All DBs Position 1706939..1707217 Genome browser AA seq 92 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAIS TVVPARNVRVGPGGGYVQSNEGNQAEDDDVEQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaggacccgttcctcaacgcgctgcggcgcgagcgggtg ccggtgtctgtgtatctggtcaacggcatcaagctgcagggcacgatcgagtcgttcgac cagttcgtggtcctgctgcgcaacaccgtgagtcagatggtctacaagcacgccatctcc acggtcgtgccggcgcgcaatgtgcgcgtggggccgggtggcgggtatgtgcaatccaat gaaggcaatcaggcggaagatgacgacgtcgagcagtaa

DBGET integrated database retrieval system