Xanthomonas cucurbitae: EBN15_15435 Help Entry EBN15_15435       CDS       T06553                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xcz  Xanthomonas cucurbitae Pathway xcz00290   Valine, leucine and isoleucine biosynthesis xcz00650   Butanoate metabolism xcz00660   C5-Branched dibasic acid metabolism xcz00770   Pantothenate and CoA biosynthesis xcz01100   Metabolic pathways xcz01110   Biosynthesis of secondary metabolites xcz01210   2-Oxocarboxylic acid metabolism xcz01230   Biosynthesis of amino acids Module xcz_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xcz_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xcz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     EBN15_15435    00660 C5-Branched dibasic acid metabolism     EBN15_15435   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     EBN15_15435   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     EBN15_15435 Enzymes [BR:xcz01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      EBN15_15435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  QHG88124 LinkDB All DBs Position 3543395..3543652 Genome browser AA seq 85 aa AA seqDB search MRYRLDLVLKPAEGALVRVIGMTERRGFRLCAIQGAAQPDGSGRWHLQLDVDSSRPPETL RLQLQKVYDCESVAITALESVEAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcgttaccggcttgatctggtgctgaagccggccgagggcgccttggtgcgcgtgatc ggcatgaccgagcgacgcggcttccgtctctgtgccatccagggcgccgcacaaccggat gggtccggccgctggcacctgcaactggatgtggacagcagccgtccgccggaaacgctg cgcctgcagttgcagaaggtgtacgactgcgaatccgttgcgattaccgcgctggaatcg gtggaggccgccgcatga

DBGET integrated database retrieval system