Xanthobacter dioxanivorans: EZH22_20690 Help Entry EZH22_20690       CDS       T07733                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism xdi  Xanthobacter dioxanivorans Pathway xdi02024   Quorum sensing xdi03018   RNA degradation Brite KEGG Orthology (KO) [BR:xdi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     EZH22_20690 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     EZH22_20690 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:xdi03019]     EZH22_20690 (hfq)    03036 Chromosome and associated proteins [BR:xdi03036]     EZH22_20690 (hfq) Messenger RNA biogenesis [BR:xdi03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      EZH22_20690 (hfq) Chromosome and associated proteins [BR:xdi03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     EZH22_20690 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 AcMNPV_AC11 Motif Other DBs NCBI-ProteinID:  QRG09765 UniProt:  A0A974PU71 LinkDB All DBs Position complement(4444075..4444329) Genome browser AA seq 84 aa AA seqDB search MAAERTQNLQDTFLNHVRKNKTPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKH AISTIMPGHPVQLFDPTDDAGEKA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcggcggaacggacacaaaatctccaagacactttcctcaaccacgtccgcaagaac aagacacctctcacgatattcctggtaaacggggtgaaattgcagggcgtcgtcacttgg ttcgataatttctgcgtgctgctgcgccgcgacggacattcccagctggtttacaagcac gccatttccaccatcatgccgggacatccggtgcaattgttcgatcccaccgatgatgcg ggagaaaaggcataa

DBGET integrated database retrieval system