Xanthobacter dioxanivorans: EZH22_22710
Help
Entry
EZH22_22710 CDS
T07733
Name
(GenBank) ABC transporter ATP-binding protein
KO
K11085
ATP-binding cassette, subfamily B, bacterial MsbA [EC:
7.5.2.6
]
Organism
xdi
Xanthobacter dioxanivorans
Pathway
xdi02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
xdi00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
EZH22_22710
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
xdi02000
]
EZH22_22710
Enzymes [BR:
xdi01000
]
7. Translocases
7.5 Catalysing the translocation of carbohydrates and their derivatives
7.5.2 Linked to the hydrolysis of a nucleoside triphosphate
7.5.2.6 ABC-type lipid A-core oligosaccharide transporter
EZH22_22710
Transporters [BR:
xdi02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
EZH22_22710
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
SMC_N
RsgA_GTPase
AAA_22
Zeta_toxin
AAA_29
AAA_16
AAA_30
AAA_21
AAA_23
Motif
Other DBs
NCBI-ProteinID:
QRG05813
UniProt:
A0A974SIY0
LinkDB
All DBs
Position
complement(4877629..4879440)
Genome browser
AA seq
603 aa
AA seq
DB search
MVLRRLLLSDGRKHWRGYALAFLFMGLMAACTAGLAYLMNDAVNAIFVQPTPAAVWAVSG
VVMALSIIKGASAYGQSITMARVGNRIVADNQKRAFDQILMQDASYFSRHHTAEISTRFT
MGANGARGTLDLVVTSIGRDFLSLAMLAAVAFVQDPFLAVIALVVMPAAVIGTRKLIKRA
RSIFATGFTSGVKLSSIAMEVFQGVRTVKAYTLEPEMRTRAHNFIDDVEVNANRLVRTQA
KSSPLMETLGGLAIGGVILYAGYNVIELGRSPGQFFSVLTALLLAYEPAKRLARLHVELV
SHVMGARMLFELLDAPAPDQDAPGIPDMPRPRGQVEFRAVEFGYRPGEHVLRGLDLVAEP
GQTTALVGQSGGGKSTIINLIERFYDPQGGAVLIDGVDTRTVTRSSVRASVALVSQDVYL
FSGSVRENIGFGRPGAAEADIIAAARAAHAHDFIMGFEKGYDTAVGEHGTQLSGGQRQRI
AIARAFLKNAPILLLDEATAALDSESEAEVQKALNELQHARTTIVIAHRLQTVVRAHRIC
VVEHGRVVESGTHEELIARRGRYYGFYYAQFAHEQGEGRATGEPAMDAPADTAPAPDGTR
LRA
NT seq
1812 nt
NT seq
+upstream
nt +downstream
nt
atggtgctgcggcgtctcctcctgtccgatggccgcaagcactggcgtggctatgccctc
gccttcctcttcatgggcctcatggccgcctgcaccgcgggcctcgcctatctcatgaac
gatgcggtgaacgccattttcgtgcagccgacgccggccgccgtgtgggcggtgtccggc
gtggtcatggcgctgtccatcatcaagggcgcctcggcctacgggcaaagcatcaccatg
gcgcgggtgggcaaccgcatcgtcgccgacaaccagaagcgcgcgttcgaccagatcctg
atgcaggacgcgtcctatttctcccgccaccacaccgccgagatttccacccgcttcacg
atgggagcgaacggcgcccgcgggaccctcgaccttgtcgtcaccagcatcggccgcgac
ttcctttcgctggcgatgctcgcggcggtcgccttcgtgcaggaccccttccttgccgtc
atcgcgctggtggtgatgccggcggcggtgatcggcacgcgcaagctgatcaagcgggcg
aggagcatcttcgccaccggcttcacctcgggggtgaagctttcctccatcgccatggag
gtgttccagggcgtgcggacggtgaaggcctatacgctcgaaccggagatgcgcacccgc
gcccacaatttcatcgacgacgtggaggtgaacgccaatcgcctggtgcgcacccaggca
aagtcgagcccgctcatggagacgctgggcggcctcgccatcggcggcgtcattctctat
gccggctacaatgtgatcgagctcggccgttcgccggggcagttcttctcggtgctcacc
gcgctgctcctcgcctacgagccggccaagcgcctcgcccggctgcacgtggagctggtg
agccacgtgatgggcgcgcgcatgctgttcgaactgctggacgcgcctgcgccggatcag
gatgcacccggcattccggacatgccccggccgcgcgggcaggtggaattccgcgcggtg
gagttcggctaccgccccggcgagcacgtgctgcgcggcctcgacctggtggccgagccg
ggccagacgaccgcgctggtcggccagtccggcggcggcaagtccaccatcatcaacctc
atcgagcgcttctacgacccgcaggggggcgccgtgctcatcgacggggtggatacgcgt
accgtcacgcgcagctcggtccgtgccagcgtcgcgctggtgagccaggacgtctacctc
ttctccggcagcgtgcgggagaatatcggcttcggccggcccggcgcggccgaagccgac
atcatcgcagcggcgcgggcggcccatgcgcatgatttcatcatgggcttcgagaagggc
tacgacaccgccgtcggcgagcacgggacgcagctgtcgggcggccagcgccagcgcatc
gccatcgcccgggccttcctcaagaacgcgcccatcctgctgctcgacgaggccaccgcg
gcgcttgattcggaatcggaagccgaagtgcagaaggccctgaacgagctgcagcacgcg
cgcaccaccatcgtcatcgcccatcgcctgcagacggtggtgcgggcacaccggatctgc
gtcgtcgagcacgggcgggtggtggagagcggcactcacgaggagctgatcgcccggcgc
gggcgctattacggcttctattacgcccagttcgcccacgagcagggtgaaggccgcgcg
accggggagccggcgatggatgcccccgcagacacggctccggcccctgacgggacacgg
ttgcgcgcctga
DBGET
integrated database retrieval system