Xanthobacter dioxanivorans: EZH22_27240 Help Entry EZH22_27240       CDS       T07733                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism xdi  Xanthobacter dioxanivorans Brite KEGG Orthology (KO) [BR:xdi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:xdi03110]     EZH22_27240 (grxC) Chaperones and folding catalysts [BR:xdi03110]  Protein folding catalysts   Protein disulfide isomerase    EZH22_27240 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_2 GST_N_3 SH3BGR Thioredoxin_3 Thioredoxin_2 TXD17-like_Trx Motif Other DBs NCBI-ProteinID:  QRG06578 UniProt:  A0A974SJM8 LinkDB All DBs Position complement(5863858..5864112) Genome browser AA seq 84 aa AA seqDB search MKPIEIYTKSWCPYCHSAKALLRRKGWTFTEIDVTTDKEGQLEMTRRAGGRTSVPQIFIG DTHVGGSDDLYALEEAGRLDALAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaagcccatcgagatctataccaagagctggtgcccctattgccattccgccaaggca ttgctgcggcgcaaaggctggaccttcaccgagatcgacgtgaccaccgacaaggagggc cagctggagatgacccgccgcgccggcgggcgcacctccgttccacagatcttcatcggc gacacccacgtgggtggcagcgatgacctctacgccctggaagaggccggccgcctcgac gccctggccgcctga

DBGET integrated database retrieval system