Xenorhabdus doucetiae: XDD1_2502 Help Entry XDD1_2502         CDS       T03784                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism xdo  Xenorhabdus doucetiae Pathway xdo00998   Biosynthesis of various antibiotics xdo01100   Metabolic pathways xdo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xdo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XDD1_2502 (acpP)    00074 Mycolic acid biosynthesis     XDD1_2502 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XDD1_2502 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 Ribosomal_L50 DUF5798 Motif Other DBs NCBI-ProteinID:  CDG18201 UniProt:  A0A068QU92 LinkDB All DBs Position complement(2646749..2646985) Genome browser AA seq 78 aa AA seqDB search MSTIDERVKKIIVEQLGVKEEEVVNTASFVDDLGADSLDTVELVMALEEEFDIEIPDEEA EKITTVQAAIDYVENAGK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgacgaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagag gaagaagttgtgaacacagcttcatttgttgatgacttgggcgctgattctcttgacaca gttgaactggtaatggctctggaagaagagttcgatatcgagatcccagacgaagaagct gaaaaaatcactacagttcaggctgctattgactacgttgaaaacgcaggtaaataa

DBGET integrated database retrieval system