Xenorhabdus doucetiae: XDD1_3462 Help Entry XDD1_3462         CDS       T03784                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xdo  Xenorhabdus doucetiae Pathway xdo00998   Biosynthesis of various antibiotics xdo01100   Metabolic pathways xdo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xdo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XDD1_3462    00074 Mycolic acid biosynthesis     XDD1_3462   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XDD1_3462 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF2102 Motif Other DBs NCBI-ProteinID:  CDG19152 UniProt:  A0A068QVW7 LinkDB All DBs Position 3659086..3659343 Genome browser AA seq 85 aa AA seqDB search MQELYIEIKRLIIDTLNLEDLTPAEIETDAPLFGDGLGLDSIDALELGLAVKNCYGIVLS SESEEMRQHFTSVATLAAYIQSQKA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagagttatatattgaaataaaacgattgattatagacaccctgaatctggaagat cttacccctgcggagattgagaccgatgcccccctgtttggtgacggcttaggcttagat tcaatcgatgctctggagctggggctggcagtaaaaaattgctatggcatcgtactctcc tctgaaagcgaagagatgcgtcaacacttcacttctgtcgctacactggccgcttacatc caatcacagaaagcataa

DBGET integrated database retrieval system