Xenorhabdus doucetiae: XDD1_3463 Help Entry XDD1_3463         CDS       T03784                                  Symbol acpP Name (GenBank) Acyl carrier protein 2   KO K02078   acyl carrier protein Organism xdo  Xenorhabdus doucetiae Pathway xdo00998   Biosynthesis of various antibiotics xdo01100   Metabolic pathways xdo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xdo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XDD1_3463 (acpP)    00074 Mycolic acid biosynthesis     XDD1_3463 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XDD1_3463 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding LRRFIP DUF4809 Motif Other DBs NCBI-ProteinID:  CDG19153 UniProt:  A0A068QW23 LinkDB All DBs Position 3659358..3659606 Genome browser AA seq 82 aa AA seqDB search MEKQKIFQEVSQLLVQLFELSAEDITPESRLYEDLELDSIDAVDMVVHLQKKTGRKIKPE AFKSVRTVQDVVDAVEQLLKEQ NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggaaaaacaaaagatttttcaggaagtttctcagttattggttcagttatttgaactg tctgccgaagatattacgcctgaatcacgactctatgaagatctggaactcgacagtatt gatgccgttgatatggttgtccacttacagaagaaaaccggacgcaaaatcaaaccggaa gcattcaagtctgtccgtaccgtacaggatgtcgtggatgcggtagaacagttgttgaaa gaacaataa

DBGET integrated database retrieval system