Xanthomonas dyei: NYR95_06190 Help Entry NYR95_06190       CDS       T09460                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xdy  Xanthomonas dyei Pathway xdy00998   Biosynthesis of various antibiotics xdy01100   Metabolic pathways xdy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xdy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NYR95_06190 (acpP)    00074 Mycolic acid biosynthesis     NYR95_06190 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NYR95_06190 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  WOB55151 LinkDB All DBs Position 1408277..1408516 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacaactcggcgtcaaggaa gaggaagtcaccaccagcgcatcgttcgtcgatgacctgggtgccgactcgctggacacc gtcgagctggtgatggcgctggaagaagagttcgagtgcgagatcccggacgaagaggcc gagaagatcacctcggtccagcaggcgatcgactacgtcaaggctcacgtcaagagctga

DBGET integrated database retrieval system