Xanthomonas dyei: NYR95_18180 Help Entry NYR95_18180       CDS       T09460                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xdy  Xanthomonas dyei Pathway xdy00290   Valine, leucine and isoleucine biosynthesis xdy00650   Butanoate metabolism xdy00660   C5-Branched dibasic acid metabolism xdy00770   Pantothenate and CoA biosynthesis xdy01100   Metabolic pathways xdy01110   Biosynthesis of secondary metabolites xdy01210   2-Oxocarboxylic acid metabolism xdy01230   Biosynthesis of amino acids Module xdy_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xdy_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xdy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     NYR95_18180    00660 C5-Branched dibasic acid metabolism     NYR95_18180   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     NYR95_18180   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     NYR95_18180 Enzymes [BR:xdy01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      NYR95_18180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  WOB53243 LinkDB All DBs Position 4188370..4188627 Genome browser AA seq 85 aa AA seqDB search MRYRLDLVLKPAEGALVRVIGMTERRGFRPCAIQGAAAPDDAGRWHLQLDVDSSRPPETL RLQLEKVYDCESVMITALESVEAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcgttaccggcttgacctggtgctgaagccggccgaaggcgcactggtgcgcgtgatc ggtatgaccgagcgccgcgggtttcgcccgtgcgccatccagggcgcggccgcgcccgac gatgccggtcgctggcatctgcagctggatgtggacagcagccggccgccggaaacgctg cgcctgcagctggaaaaggtctacgactgcgagtcggtgatgattacggcgctggaatcg gtcgaggcggccgcatga

DBGET integrated database retrieval system