Xenia sp. Carnegie-2017 (soft corals): 124434839 Help Entry 124434839         CDS       T08024                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism xen  Xenia sp. Carnegie-2017 (soft corals) Pathway xen04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:xen00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124434839  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:xen04121]     124434839    03400 DNA repair and recombination proteins [BR:xen03400]     124434839 Ubiquitin system [BR:xen04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      124434839    Cul5 complex      124434839 DNA repair and recombination proteins [BR:xen03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      124434839 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 GcvP2_C Motif Other DBs NCBI-GeneID:  124434839 NCBI-ProteinID:  XP_046840720 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEIFVMVRRAKLTMFLDCTESTTVSELKKMVEGITKMSPEDQRLYKDEQPLDDTKTLGDY GFTSVTARPQSPAMIGLACKIEGTDDWETLNIADLSTPPDPPDVMMPQDGNSAEAK NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggagatttttgtaatggttcgacgagccaagttgacaatgtttcttgattgcactgaa tctacgactgtttctgagttaaagaaaatggttgagggcattacaaagatgtcgcctgaa gatcagagactatacaaagatgagcaaccacttgatgatactaaaacattgggagattat ggtttcaccagtgtgacagcaagacctcaaagtcctgccatgattggcttagcctgtaaa attgaaggtactgatgattgggagacccttaacattgcagatctatcaacaccacccgac cccccagatgtaatgatgcctcaagatggaaacagtgcagaagccaagtga

DBGET integrated database retrieval system