Xenia sp. Carnegie-2017 (soft corals): 124434890 Help Entry 124434890         CDS       T08024                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism xen  Xenia sp. Carnegie-2017 (soft corals) Pathway xen04137   Mitophagy - animal xen04140   Autophagy - animal xen04144   Endocytosis xen04145   Phagosome xen04148   Efferocytosis Brite KEGG Orthology (KO) [BR:xen00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124434890    04145 Phagosome     124434890    04140 Autophagy - animal     124434890    04137 Mitophagy - animal     124434890    04148 Efferocytosis     124434890  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xen04131]     124434890   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xen04147]     124434890    04031 GTP-binding proteins [BR:xen04031]     124434890 Membrane trafficking [BR:xen04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     124434890 Exosome [BR:xen04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124434890   Exosomal proteins of other body fluids (saliva and urine)    124434890   Exosomal proteins of colorectal cancer cells    124434890   Exosomal proteins of bladder cancer cells    124434890 GTP-binding proteins [BR:xen04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     124434890 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW ATP_bind_1 nSTAND3 Septin AAA_16 PduV-EutP AAA_22 AAA_7 NTPase_1 AAA_24 AAA_5 ATPase_2 NACHT NB-ARC AAA_14 ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  124434890 NCBI-ProteinID:  XP_046840783 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTQPGSFKTLDSWRDEFLIQASPRDPENFPF VVLGNKVDLENRAVSAKRAQGWCQAKNNIPYFETSAKEAINVEQAFQTIAKNALAQETEV ELYNDFPDQIHLDNNTSKPKDGCGC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaagaaaaaaggttctgttgaaagtgataatcctgggagatagtggggtcggt aagacatccttgatgaaccagtatgtaaataagaaatttagtaatcagtacaaagcaact attggtgcggatttcttaacaaaggaagtaatggttgacgataggcttgttaccatgcag atttgggacacagctggacaagagagattccaaagtctgggtgtagcattctaccgcggt gcagattgctgtgtcctagtatttgacgtaactcaaccaggatcattcaagactctagac agttggcgtgacgagtttcttatccaagctagccctagagatcctgagaactttccgttt gtggtgttaggaaataaagttgatttggaaaacagagcagtgtctgctaagagagcgcaa ggttggtgtcaagcaaagaacaacataccgtactttgagacgagcgccaaagaagcaatt aatgtagaacaagcatttcagaccattgcaaagaatgcgctagctcaggaaacagaagtg gagttatataatgatttcccagatcaaatccaccttgacaacaatacaagtaaaccaaaa gatggctgcggttgctaa

DBGET integrated database retrieval system