Xenia sp. Carnegie-2017 (soft corals): 124435527 Help Entry 124435527         CDS       T08024                                  Name (RefSeq) ras-related protein Rac1-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism xen  Xenia sp. Carnegie-2017 (soft corals) Pathway xen04145   Phagosome xen04148   Efferocytosis xen04310   Wnt signaling pathway xen04517   IgSF CAM signaling xen04518   Integrin signaling xen04620   Toll-like receptor signaling pathway xen05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:xen00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     124435527   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     124435527    04518 Integrin signaling     124435527  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     124435527    04148 Efferocytosis     124435527  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124435527  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     124435527  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xen04131]     124435527   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xen04147]     124435527    04031 GTP-binding proteins [BR:xen04031]     124435527 Membrane trafficking [BR:xen04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     124435527  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     124435527   Macropinocytosis    Ras GTPases     124435527  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     124435527 Exosome [BR:xen04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124435527   Exosomal proteins of other body fluids (saliva and urine)    124435527   Exosomal proteins of colorectal cancer cells    124435527   Exosomal proteins of bladder cancer cells    124435527 GTP-binding proteins [BR:xen04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     124435527 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU TniB Motif Other DBs NCBI-GeneID:  124435527 NCBI-ProteinID:  XP_046841454 LinkDB All DBs Position Unknown AA seq 201 aa AA seqDB search MPKSKGFFNVIIVGDSKVGKTCLLYSYKGGKRPEEKIPGFLQTFTCKVKVNCKKVELGIW DTSGDSQYDGLRRLVYVSGDIFVVCYSVDSRQSFENVTKKWLPELRKCGQPNAAVVVVAT KKDLRPRTSVMPRSVDGIDGRSTRDSFVTYDEGLQLAHEIRAKAFVECSVQNESSTCNVL GEVANILLKQLAKEKEKKRDS NT seq 606 nt NT seq  +upstreamnt  +downstreamnt atgccgaaaagtaaaggttttttcaacgttatcatcgtgggtgacagtaaagttggcaaa acatgtttgctatactcgtacaaaggcgggaaaaggccagaagaaaaaattcccggtttt cttcaaacgtttacgtgcaaagttaaagttaactgtaaaaaagtggagttagggatttgg gacacctctggtgattcgcaatacgacggtctacgaagactggtatacgtgagtggggat atctttgtcgtttgttactcggtggatagtcgccagagcttcgagaacgtcacgaaaaaa tggctgcctgaattgaggaaatgtggacagccgaacgctgcagtcgttgttgtggcaacg aaaaaggatttgcgaccacgtaccagtgttatgccaagatcagtcgatggcatagatgga agaagtacgcgtgacagtttcgtgacgtatgacgaaggtcttcaactagctcacgagatt cgagccaaggcatttgttgaatgctcggtgcaaaacgagtctagcacttgcaatgtttta ggagaagtggccaacatccttttaaaacaattagcaaaggaaaaggagaagaaaagagac tcttag

DBGET integrated database retrieval system