Xenia sp. Carnegie-2017 (soft corals): 124442995 Help Entry 124442995         CDS       T08024                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism xen  Xenia sp. Carnegie-2017 (soft corals) Pathway xen04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:xen00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     124442995  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:xen01009]     124442995   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xen04131]     124442995    03036 Chromosome and associated proteins [BR:xen03036]     124442995   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xen04147]     124442995 Protein phosphatases and associated proteins [BR:xen01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      124442995 Membrane trafficking [BR:xen04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     124442995 Chromosome and associated proteins [BR:xen03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      124442995 Exosome [BR:xen04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    124442995 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_8 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_9 AIF-1 EF-hand_5 UPF0154 Phage_TAC_12 TerB RNA_pol_Rpb4 EH SPARC_Ca_bdg Mu-like_Pro CCM2_C Vma12 Motif Other DBs NCBI-GeneID:  124442995 NCBI-ProteinID:  XP_046849476 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MFDVNDNGTVGTEELKKVMAKLGQNPSEKEIQEMINEVDEDGSGAVDFDEFCQMMAKQLA TALKEELNEALKTFIPGGSISAKEWRKILCSLSEKMSNDEVDDLLKIADKSRRGNIKNED IVNVLFG NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgttcgatgtgaacgataatggaacggttggaactgaagaattgaagaaagtgatggca aagcttggacagaatccctccgagaaagaaatccaggagatgattaatgaagttgacgaa gatggctccggtgcagtagatttcgatgaattctgccagatgatggcgaaacagctagca acagctctcaaagaggaactcaatgaagcgttgaaaacatttatacctggtggtagcatc tcggcgaaagaatggagaaaaatactttgtagtttatcagaaaaaatgtccaacgatgaa gttgacgacctcctaaagattgccgataaaagtcgacgaggaaacatcaagaatgaagat atagtgaatgttctctttggttga

DBGET integrated database retrieval system