Xenia sp. Carnegie-2017 (soft corals): 124443484 Help Entry 124443484         CDS       T08024                                  Name (RefSeq) ras-like protein RAS2   KO K07830   Ras-related protein R-Ras2 Organism xen  Xenia sp. Carnegie-2017 (soft corals) Pathway xen04137   Mitophagy - animal xen04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:xen00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124443484    04137 Mitophagy - animal     124443484  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xen04147]     124443484    04031 GTP-binding proteins [BR:xen04031]     124443484 Exosome [BR:xen04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    124443484   Exosomal proteins of bladder cancer cells    124443484 GTP-binding proteins [BR:xen04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     124443484 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf RsgA_GTPase Tir_receptor_N Motif Other DBs NCBI-GeneID:  124443484 NCBI-ProteinID:  XP_046849896 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MREQYMRSGEGFLLVFSLTDRASFDEINKFYNQILRVKDRSEFSMIIVGNKSDLERERVV SSQEGNELGRQLRIPYIEASAKTRTNVDAAFHDLVRAIRKMKFYAQHEAPQKKPKKKKCI IL NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgagggagcagtacatgagaagtggggaaggattcttattggtgttctcacttacagat agggcgagttttgacgaaatcaataaattttacaatcaaattttaagagttaaagacaga agtgaattttccatgataatagtgggaaacaaatctgatttagaacgcgagagagtggtt tcatctcaagaaggaaatgaattaggaaggcaattgaggatcccatatattgaagctagc gccaaaacgagaacaaatgttgacgctgctttccatgacctcgtaagagcaattaggaaa atgaagttttatgctcaacacgaagcgcctcagaaaaaaccgaagaagaaaaaatgcatt atcttataa

DBGET integrated database retrieval system