Xenia sp. Carnegie-2017 (soft corals): 124444664 Help Entry 124444664         CDS       T08024                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism xen  Xenia sp. Carnegie-2017 (soft corals) Pathway xen04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:xen00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124444664  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:xen04121]     124444664    03400 DNA repair and recombination proteins [BR:xen03400]     124444664 Ubiquitin system [BR:xen04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      124444664    Cul5 complex      124444664 DNA repair and recombination proteins [BR:xen03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      124444664 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  124444664 NCBI-ProteinID:  XP_046851253 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MANEPGYGSCEGPEAQYVKLISSDGHEFVVKRCYALTSGTIKAMLSGPGQFSENETNEVH FREIPSHILSKVCMYFLYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggcaaatgaaccaggttatggtagctgtgaggggcctgaggcccaatatgtgaagctc atctcgagcgatggtcatgaatttgttgtgaagcgctgttatgccttaacatcaggaacc atcaaagcaatgcttagtggaccaggtcagttttctgagaacgagaccaatgaagtccac tttcgagagattccatcgcacatcctttcaaaggtttgtatgtatttcttatacaaagtc cgatatacaaacagcagtacagaaatacccgagttcccaattgcaccagaaattgcattg gagttgctcatggctgccaacttccttgattgctga

DBGET integrated database retrieval system