Xanthomonas euroxanthea: XSP_003292 Help Entry XSP_003292        CDS       T07902                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xeu  Xanthomonas euroxanthea Pathway xeu00290   Valine, leucine and isoleucine biosynthesis xeu00650   Butanoate metabolism xeu00660   C5-Branched dibasic acid metabolism xeu00770   Pantothenate and CoA biosynthesis xeu01100   Metabolic pathways xeu01110   Biosynthesis of secondary metabolites xeu01210   2-Oxocarboxylic acid metabolism xeu01230   Biosynthesis of amino acids Module xeu_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xeu_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xeu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     XSP_003292    00660 C5-Branched dibasic acid metabolism     XSP_003292   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     XSP_003292   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     XSP_003292 Enzymes [BR:xeu01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      XSP_003292 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  CAD1795368 UniProt:  A0A6V7N5A0 LinkDB All DBs Position 1:3927851..3928108 Genome browser AA seq 85 aa AA seqDB search MRYRLDLVLTPAEGALVRVLGMTERRGFRPCAIQGACAPDDAGRWHLQLDVDSTRPPETL RLQLEKVYDCESVVITALDSVEVAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcgttaccggcttgatctggtgctgacgccggccgaaggcgcactggtgcgcgtgctc ggcatgaccgagcgacgcggctttcgcccctgcgccatccagggcgcctgcgcaccggac gatgccggccgctggcatctgcaactggacgtggacagcacgcgcccgccggagacgctg cgcctgcagctggaaaaagtgtacgactgcgagtcggtggtgatcaccgcgctggactcg gtcgaggttgcggcatga

DBGET integrated database retrieval system