Xylella fastidiosa 9a5c: XF_0089 Help Entry XF_0089           CDS       T00033                                  Name (GenBank) host factor-I protein   KO K03666   host factor-I protein Organism xfa  Xylella fastidiosa 9a5c Pathway xfa02024   Quorum sensing xfa03018   RNA degradation Brite KEGG Orthology (KO) [BR:xfa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     XF_0089  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     XF_0089  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:xfa03019]     XF_0089    03036 Chromosome and associated proteins [BR:xfa03036]     XF_0089 Messenger RNA biogenesis [BR:xfa03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      XF_0089 Chromosome and associated proteins [BR:xfa03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     XF_0089 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AAF82902 UniProt:  Q9PH57 LinkDB All DBs Position complement(89712..89990) Genome browser AA seq 92 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAIS TVVPARNVRVGPGGGYVQSGSDTLQINDDEVE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaggatccttttctaaacgcattgcgtcgcgaacgggta cctgtgtcgatctatctagtgaatggcatcaaactacaaggcacaatcgaatcattcgat caatttgtggttctactacgtaatactgtcagccagatggtgtacaagcatgctatttcc acagtggtacctgcgcgcaacgtacgagttgggccaggtggaggctatgtgcagtcaggc agtgatacgttgcaaattaacgatgacgaagtggaatga

DBGET integrated database retrieval system