Xylella fastidiosa 9a5c: XF_0564 Help Entry XF_0564           CDS       T00033                                  Name (GenBank) conserved hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism xfa  Xylella fastidiosa 9a5c Pathway xfa03060   Protein export xfa03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:xfa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     XF_0564  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     XF_0564  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:xfa02044]     XF_0564 Secretion system [BR:xfa02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    XF_0564 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Conotoxin Motif Other DBs NCBI-ProteinID:  AAF83374 UniProt:  Q9PFU3 LinkDB All DBs Position complement(550357..550572) Genome browser AA seq 71 aa AA seqDB search MGSFSLLHWLVVLVIVLLVFGTKRLANGAKDIGSAIKEFKKSLREDDKPTDQLGSTSQST ASGPQQDHGKH NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgggcagcttcagcctcctccactggctggtcgtgctggtcatcgtcctgttggtgttc ggcaccaagcgacttgccaatggcgccaaagatattggaagcgccattaaagagttcaaa aaaagcctacgcgaagacgacaaaccgaccgatcagcttggcagcacctcccagagcacc gcttccggaccccaacaggatcatggtaagcactga

DBGET integrated database retrieval system