Xylella fastidiosa 9a5c: XF_0771 Help Entry XF_0771           CDS       T00033                                  Name (GenBank) ACP   KO K02078   acyl carrier protein Organism xfa  Xylella fastidiosa 9a5c Pathway xfa01100   Metabolic pathways xfa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xfa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XF_0771    00074 Mycolic acid biosynthesis     XF_0771   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XF_0771 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AAF83581 UniProt:  Q9PFA7 LinkDB All DBs Position 722259..722579 Genome browser AA seq 106 aa AA seqDB search MLMPDLCAPFIVWGLFQMSVQTPAERELAELIVESLNLEDVQSGEIDPEAPLFNTGLGLD SIDALELALVITKRYGFQMRSDNDDNQRIFASLRALSDHVQAHRRT NT seq 321 nt NT seq  +upstreamnt  +downstreamnt gtgctgatgcctgatctttgtgcaccgtttattgtttggggcctcttccagatgtctgtg caaactcccgctgagcgcgaactggctgagttaattgtggaaagtctcaatcttgaggat gtccagtctggggagattgatccggaagcgccgttgtttaacacggggctgggcctggat tcgattgacgcgctggaattagcgctggtgattaccaagcgttatggtttccagatgcgt tcggacaatgatgacaaccaacgtatctttgcttcgctgcgtgcgctttcagatcatgtt caagcgcacagaagaacctga

DBGET integrated database retrieval system