KEGG   Xylella fastidiosa 9a5c: XF_1067
Entry
XF_1067           CDS       T00033                                 
Name
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10112  multiple sugar transport system ATP-binding protein [EC:7.5.2.-]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
xfa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xfa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    XF_1067
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xfa02000]
    XF_1067
Transporters [BR:xfa02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter
    XF_1067
   Maltose transporter
    XF_1067
   Arabinogalactan oligomer/maltooligosaccharide transport system
    XF_1067
   Raffinose/stachyose/melibiose transporter
    XF_1067
   Alpha-glucoside transporter
    XF_1067
   Glucose/mannose transporter
    XF_1067
   Trehalose/maltose transporter
    XF_1067
   Cellobiose transporter
    XF_1067
   N,N'-Diacetylchitobiose transporter
    XF_1067
   L-Arabinose/D-xylose transporter
    XF_1067
   Fructooligosaccharide transporter
    XF_1067
   Putative sorbitol/mannitol transporter
    XF_1067
   Arabinooligosaccharide transporter
    XF_1067
   Polygalacturonan/rhamnogalacturonan transporter
    XF_1067
   Pectin-derived oligosaccharide transporter
    XF_1067
   Putative multiple sugar transporter
    XF_1067
SSDB
Motif
Pfam: ABC_tran TOBE_2 OB_MalK AAA_21 SMC_N TOBE RsgA_GTPase AAA_22 ORC-CDC6-like Rad17 AAA_16 AAA_29 NACHT AAA nSTAND1 AAA_30 AAA_25 AAA_33 AAA_28 AAA_23 AAA_5 ATPase_2 TAF NB-ARC nSTAND3 AAA_14 AAA_15 RNA_helicase
Other DBs
NCBI-ProteinID: AAF83877
UniProt: Q9PEG1
LinkDB
Position
1024805..1025899
AA seq 364 aa
MAKVQLEAIRKVYDNGQVVVPGVSFEVADGELMVLVGPSGCGKSTLLRMIAGLEDISSGT
LRIGERVVNDVPPKDRNVAMVFQSYALYPHMTAAENLAFGLKLRGYSTEAIAERIKNVAE
MLGLTSLLDTLPKAMSGGQRQRVALGRAMVRESAVFLLDEPLSNLDAKLRNSVRSDITRL
HRKLGTTMIYVTHDQVEAMTLGHRIVLLKDGVIQQIDTPMVLYDHPANLFVAGFLGNPAM
NMLPGRLEAVAGGMELHLESGECVMFVGAIPKSVWFGRDVVLGVRPEHIRPAGLGEPVAL
EATVEALEPVGNEVFLHLRCGALALTLRVPPQELPGIGESLPLAVQPDRLHVFDAVSGEC
LAGH
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggccaaagtgcagttggaagcgatccgtaaggtgtacgacaacggccaggtggtggtg
cctggagtcagtttcgaagttgctgacggtgagctgatggtgttggtgggaccgtcagga
tgcggtaaatcgacgttgttgcgcatgatcgctgggctggaagatatcagcagtggcacg
ttgcgtattggtgagcgtgtggtgaatgacgtgccgccgaaggatcgtaatgttgcaatg
gtgtttcagagctatgcgttgtatccccatatgacggccgctgagaatttggcgttcggg
ctgaagctgcgcgggtattctactgaggccattgccgagcgcattaagaatgtggccgag
atgcttggtttgacttctctgctggataccttgcctaaagcgatgtctggtgggcagcgc
cagcgcgttgcgttggggcgggcgatggtacgtgaatcagcagtgtttttattggatgag
ccgttgtccaatttagacgcaaaactgcgtaacagtgtgcgttccgatatcacgcgtctg
catcgcaaacttggcacgacgatgatttacgtgacccacgatcaggttgaggcgatgact
ctcggtcaccgtattgtgttgctcaaagatggagtgatccagcagattgataccccgatg
gtgctttacgaccatccggcgaatctgtttgttgctggttttcttggtaatccagcaatg
aacatgttgcctggtcgattggaggcggttgcaggtggaatggagctgcacttggaatcc
ggtgagtgcgtcatgtttgttggtgcgattccgaagtcagtttggttcgggcgtgatgtg
gtgttgggggtacgtccggagcacatacggccggcgggtcttggtgaaccagtggcattg
gaggcgactgtcgaagcgttggagccagtcggtaatgaggtttttttacatctgcgctgt
ggtgccttggcactcactttgcgggtgccgcctcaggagttgccggggatcggcgagtca
ttgccgttggcggtgcagcctgatcggttacatgtgtttgacgcggtttctggtgaatgt
ttggccggtcattaa

DBGET integrated database retrieval system