KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_02665
Entry
XFLM_02665        CDS       T01979                                 
Name
(GenBank) BFD/(2Fe-2S)-binding domain-containing protein
  KO
K02192  bacterioferritin-associated ferredoxin
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Brite
KEGG Orthology (KO) [BR:xff00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    XFLM_02665
SSDB
Motif
Pfam: Fer2_BFD CoV_S2_C
Other DBs
NCBI-ProteinID: ADN62532
LinkDB
Position
complement(550677..550901)
AA seq 74 aa
MPRVYICICNAVTDDHIYEVAASCADLAELTMRTGCGSNCGSCLNAAAELLVKARAACVM
PQSALLNLGTMCNR
NT seq 225 nt   +upstreamnt  +downstreamnt
atgccgcgcgtgtacatttgcatctgtaacgctgtcactgatgatcatatttatgaggtt
gctgccagttgtgccgatcttgccgagctgaccatgcgtactggctgtggttccaattgc
ggctcttgcttgaatgcggctgctgagcttctcgttaaagcgcgtgccgcttgtgttatg
ccgcaatcagcgttgcttaatttgggaacgatgtgcaacaggtaa

DBGET integrated database retrieval system