Xylella fastidiosa Hib4: XFHB_00355 Help Entry XFHB_00355        CDS       T04925                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism xfh  Xylella fastidiosa Hib4 Pathway xfh02024   Quorum sensing xfh03018   RNA degradation Brite KEGG Orthology (KO) [BR:xfh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     XFHB_00355 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     XFHB_00355 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:xfh03019]     XFHB_00355 (hfq)    03036 Chromosome and associated proteins [BR:xfh03036]     XFHB_00355 (hfq) Messenger RNA biogenesis [BR:xfh03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      XFHB_00355 (hfq) Chromosome and associated proteins [BR:xfh03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     XFHB_00355 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ALR05560 UniProt:  A0ABC8AAR5 LinkDB All DBs Position complement(88100..88378) Genome browser AA seq 92 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAIS TVVPARNVRVGPGGGYVQSGSDTLQINDDEVE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaggatccttttctaaacgcattgcgtcgcgaacgggta cctgtgtcgatctatctagtgaatggcatcaaactacaaggcacaatcgaatcattcgat caatttgtggttctactacgtaatactgtcagccagatggtgtacaagcatgctatttcc acagtggtacctgcgcgcaacgtacgagttgggccaggtggaggctatgtgcagtcaggc agtgatacgttgcaaattaacgatgacgaagtggaatga

DBGET integrated database retrieval system