Xylella fastidiosa Hib4: XFHB_05345 Help Entry XFHB_05345        CDS       T04925                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism xfh  Xylella fastidiosa Hib4 Brite KEGG Orthology (KO) [BR:xfh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xfh03036]     XFHB_05345 Chromosome and associated proteins [BR:xfh03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     XFHB_05345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Stathmin YabA FapA Motif Other DBs NCBI-ProteinID:  ALR06357 LinkDB All DBs Position complement(1162543..1162764) Genome browser AA seq 73 aa AA seqDB search MDQPDALTELHSLAAQLERLIEYCQRLAEENHNLRCQQHQMMLERRELLAKNEQARSRVE AMITRLKTLEQHT NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggatcagcctgatgccctcaccgaactccactctctagcagcgcagctagagaggctg atcgaatactgtcaacgtttagctgaggaaaatcacaatttgcgctgccagcagcatcag atgatgctggaacgtcgcgaacttctagcaaaaaatgaacaagcacgctcgcgcgtggaa gcaatgattacacgtcttaagaccctggagcagcacacgtga

DBGET integrated database retrieval system