Xylella fastidiosa Hib4: XFHB_06210 Help Entry XFHB_06210        CDS       T04925                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xfh  Xylella fastidiosa Hib4 Pathway xfh00290   Valine, leucine and isoleucine biosynthesis xfh00650   Butanoate metabolism xfh00660   C5-Branched dibasic acid metabolism xfh00770   Pantothenate and CoA biosynthesis xfh01100   Metabolic pathways xfh01110   Biosynthesis of secondary metabolites xfh01210   2-Oxocarboxylic acid metabolism xfh01230   Biosynthesis of amino acids Module xfh_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xfh_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xfh00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     XFHB_06210    00660 C5-Branched dibasic acid metabolism     XFHB_06210   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     XFHB_06210   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     XFHB_06210 Enzymes [BR:xfh01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      XFHB_06210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 DUF7393 Motif Other DBs NCBI-ProteinID:  ALR06495 UniProt:  A0ABC8ADG5 LinkDB All DBs Position 1353391..1353636 Genome browser AA seq 81 aa AA seqDB search MQYRLDLILRPAEGAVLRVLGMTERRGFRACAIHGSTVVNDAGRWHLQMVVDGSRSPETL RLQLEKVYDCESVSITVLEAA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcaataccggcttgatctgatcctcagacccgccgaaggtgcagtattacgtgtgcta ggcatgactgaacgtcgcggcttccgcgcctgcgcgatccacggcagtactgtcgtcaac gatgcgggccgttggcatcttcaaatggttgtggacggctcacgctcaccagagacgctg cgtttgcaactggagaaagtgtacgactgcgaatcagtatctattactgttttggaagcc gcatga

DBGET integrated database retrieval system