Xylella fastidiosa Hib4: XFHB_11420 Help Entry XFHB_11420        CDS       T04925                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xfh  Xylella fastidiosa Hib4 Pathway xfh01100   Metabolic pathways xfh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xfh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XFHB_11420    00074 Mycolic acid biosynthesis     XFHB_11420   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XFHB_11420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ALR07352 LinkDB All DBs Position complement(2469733..2470002) Genome browser AA seq 89 aa AA seqDB search MSVQTPAERELAELIVESLNLEDVQSGEIDPEAPLFNTGLGLDSIDALELALVITKRYGF QMRSDNDDNQRIFASLRALSDHVQAHRRT NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgtgcaaactcccgctgagcgcgaactggctgagttaattgtggaaagtctcaat cttgaggatgtccagtctggggagattgatccggaagcgccgttgtttaacacggggctg ggcctggattcgattgacgcgctggaattagcgctggtgattaccaagcgttatggtttc cagatgcgttcggacaatgatgacaaccaacgtatctttgcttcgctgcgtgcgctttca gatcatgttcaagcgcacagaagaacctga

DBGET integrated database retrieval system