Xylella fastidiosa MUL0034: P303_07255 Help Entry P303_07255        CDS       T03317                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xfl  Xylella fastidiosa MUL0034 Pathway xfl01100   Metabolic pathways xfl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xfl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P303_07255    00074 Mycolic acid biosynthesis     P303_07255   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P303_07255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB Motif Other DBs NCBI-ProteinID:  AIC12741 LinkDB All DBs Position complement(1480977..1481216) Genome browser AA seq 79 aa AA seqDB search MSDIEARVRKIVAEKLNVDEEKVTNTSTFVDELGADSLDTVELVMALEDEFQCEIGDEAA EKMTSVQHAIDYIKSNAKC NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacatcgaagcgcgcgtcagaaaaattgtcgccgagaaactcaatgtcgatgaa gaaaaagtaactaatacctcgacgttcgtcgatgaactgggtgcggattcgttggatacc gtcgagttggtgatggccctggaagacgagttccaatgtgagatcggtgacgaggctgct gagaagatgacttcggtgcaacatgctatcgactacattaagagtaatgctaagtgctaa

DBGET integrated database retrieval system