Xylella fastidiosa M12: Xfasm12_0154 Help Entry Xfasm12_0154      CDS       T00677                                  Name (GenBank) glycine cleavage H protein   KO K02437   glycine cleavage system H protein Organism xfm  Xylella fastidiosa M12 Pathway xfm00260   Glycine, serine and threonine metabolism xfm00630   Glyoxylate and dicarboxylate metabolism xfm00670   One carbon pool by folate xfm00785   Lipoic acid metabolism xfm01100   Metabolic pathways xfm01110   Biosynthesis of secondary metabolites xfm01200   Carbon metabolism Brite KEGG Orthology (KO) [BR:xfm00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     Xfasm12_0154   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     Xfasm12_0154   09108 Metabolism of cofactors and vitamins    00785 Lipoic acid metabolism     Xfasm12_0154    00670 One carbon pool by folate     Xfasm12_0154 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GCV_H Biotin_lipoyl Motif Other DBs NCBI-ProteinID:  ACA11191 UniProt:  B0U269 LinkDB All DBs Position complement(189486..189881) Genome browser AA seq 131 aa AA seqDB search MSDIPGDLKFLKSHEWVRIEDNNRAIVGISDHAQNLLGDLVYVELPNIGDHLDAGATAAV IESVKAASDIYSPVTGKVIEVNTTLSDKPETINEDPYGEGWIMVIEMQAPEEISDLLSPD DYTEVLESDEH NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatccctggcgacctcaagttcctcaaatcccacgaatgggtccggatcgaa gacaacaatcgtgccatcgttggcatttccgaccatgcacaaaatctgctcggtgatctg gtgtatgtcgaattacccaatattggcgatcacctggacgctggcgctaccgctgcagtc attgagtcggtcaaggcagcctcagatatctacagcccagttaccggaaaagtgattgaa gtcaatactacgttaagcgacaaacctgagacgatcaatgaagatccctacggtgaaggt tggattatggtcattgagatgcaagcccctgaggaaatcagtgatctactttctcccgat gattacaccgaagtgctggaaagtgacgaacactga

DBGET integrated database retrieval system