Xylella fastidiosa M12: Xfasm12_0964 Help Entry Xfasm12_0964      CDS       T00677                                  Name (GenBank) conserved hypothetical protein   KO K09892   cell division protein ZapB Organism xfm  Xylella fastidiosa M12 Brite KEGG Orthology (KO) [BR:xfm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xfm03036]     Xfasm12_0964 Chromosome and associated proteins [BR:xfm03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Xfasm12_0964 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Stathmin YabA FapA Motif Other DBs NCBI-ProteinID:  ACA11937 LinkDB All DBs Position complement(1042112..1042333) Genome browser AA seq 73 aa AA seqDB search MDQPDALTELHSLAAQLERLIEYCQRLAEENHNLRCQQHQMMLERRELLAKNEQARSRVE AMITRLKTLEQHT NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggatcagcctgatgccctcaccgaactccactctctagcagcgcagctagagaggctg atcgaatactgtcaacgtttagctgaggaaaatcacaatttgcgctgccagcagcatcag atgatgctggaacgtcgcgaacttctagcaaaaaacgaacaagcacgctcgcgcgtggaa gcaatgattacacgtcttaagaccctggagcagcacacatga

DBGET integrated database retrieval system