Xylella fastidiosa M12: Xfasm12_0976 Help Entry Xfasm12_0976      CDS       T00677                                  Name (GenBank) DNA-binding protein   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism xfm  Xylella fastidiosa M12 Brite KEGG Orthology (KO) [BR:xfm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:xfm03000]     Xfasm12_0976    03036 Chromosome and associated proteins [BR:xfm03036]     Xfasm12_0976    03400 DNA repair and recombination proteins [BR:xfm03400]     Xfasm12_0976 Transcription factors [BR:xfm03000]  Prokaryotic type   Helix-turn-helix    Other families     Xfasm12_0976 Chromosome and associated proteins [BR:xfm03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Xfasm12_0976 DNA repair and recombination proteins [BR:xfm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       Xfasm12_0976 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 Fis_N HTH_30 Phage_NinH BrkDBD HTH_28 Xre-like-HTH HTH_29 HTH_23 HTH_17 Motif Other DBs NCBI-ProteinID:  ACA11947 LinkDB All DBs Position complement(1051686..1051958) Genome browser AA seq 90 aa AA seqDB search MNVVPSRPEVSRGSPKSPLREHVAQVVRRYLRDLDGCDANDLYNMVLREMEIPLLVEVLN HCEGNQSRAAALLGIHRATLRKKLKEYGLV NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ttgaacgtagtaccctcccgtcccgaagtcagccgtggctccccaaagtcccccctacgt gaacatgtagctcaagtggtgcgccgttatttgcgtgatcttgatggctgcgatgccaat gatctctacaacatggtgctgcgcgaaatggagattcctctcttggtagaagtactgaac cattgtgaagggaatcagagccgtgccgctgcactgcttggcattcatcgcgccacacta cgtaagaaactcaaagagtacggattagtttga

DBGET integrated database retrieval system