Xylella fastidiosa M12: Xfasm12_2068 Help Entry Xfasm12_2068      CDS       T00677                                  Name (GenBank) dehydratase   KO K02372   3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59] Organism xfm  Xylella fastidiosa M12 Pathway xfm00061   Fatty acid biosynthesis xfm00780   Biotin metabolism xfm01100   Metabolic pathways xfm01212   Fatty acid metabolism xfm01240   Biosynthesis of cofactors Module xfm_M00083   Fatty acid biosynthesis, elongation Brite KEGG Orthology (KO) [BR:xfm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Xfasm12_2068   09108 Metabolism of cofactors and vitamins    00780 Biotin metabolism     Xfasm12_2068  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:xfm01004]     Xfasm12_2068 Enzymes [BR:xfm01000]  4. Lyases   4.2  Carbon-oxygen lyases    4.2.1  Hydro-lyases     4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase      Xfasm12_2068 Lipid biosynthesis proteins [BR:xfm01004]  Fatty acid synthase   Component type    Xfasm12_2068 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FabA ApeI-like Motif Other DBs NCBI-ProteinID:  ACA12934 LinkDB All DBs Position complement(2169398..2169685) Genome browser AA seq 95 aa AA seqDB search MEFSIPKTHPCFPGHFPGFAVVPGVLVLAQVLHALQVREGRLTGICLPQVKFLRSLLPEQ QARIELEGAMPRWRFRVCCADTLLASGEIVAGSGA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggaattttccattcctaagacgcacccctgttttcctggtcactttcctggctttgca gtggtgcctggggtgttggtgttggcgcaggtgttacatgccttgcaggtacgcgaaggc aggttgaccgggatctgtttgccacaggtcaaattcttgcggtcgctgctgccggagcag caagcgcggatcgagctggagggagccatgccgcgctggcgtttccgggtttgctgtgcg gacactcttttggccagcggcgagattgttgctgggtcgggggcatga

DBGET integrated database retrieval system