Xylella fastidiosa M12: Xfasm12_2070 Help Entry Xfasm12_2070      CDS       T00677                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xfm  Xylella fastidiosa M12 Pathway xfm01100   Metabolic pathways xfm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xfm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Xfasm12_2070    00074 Mycolic acid biosynthesis     Xfasm12_2070   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Xfasm12_2070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACA12936 LinkDB All DBs Position complement(2170642..2170911) Genome browser AA seq 89 aa AA seqDB search MSVQTPAECELAELIVESLNLEDVQSGEIDPEAPLFNTGLGLDSIDALELALAITKRYGF QMRSDNDDNQRIFASLRALSDHVQAHRRT NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgtgcaaactcccgctgagtgcgaactggctgagttaattgtggaaagtctcaat cttgaggatgtccagtctggggagattgatccggaagcgccgttgtttaacacggggctg ggcttggattcgattgacgcgttggaattggctctggcgattaccaagcgttatggtttc cagatgcgttcggacaatgatgacaaccaacgtatctttgcttcgctgcgtgcgctttca gatcatgttcaagcgcacagaagaacctga

DBGET integrated database retrieval system