Xylella fastidiosa M23: XfasM23_0846 Help Entry XfasM23_0846      CDS       T00692                                  Name (GenBank) conserved hypothetical protein   KO K09892   cell division protein ZapB Organism xfn  Xylella fastidiosa M23 Brite KEGG Orthology (KO) [BR:xfn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xfn03036]     XfasM23_0846 Chromosome and associated proteins [BR:xfn03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     XfasM23_0846 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB GAS DUF7491 Stathmin YabA Herpes_UL33 DUF3287 Motif Other DBs NCBI-ProteinID:  ACB92283 UniProt:  B2IAK3 LinkDB All DBs Position complement(999196..999417) Genome browser AA seq 73 aa AA seqDB search MDQPDALTELHSLAAQLERLIEYCQRLAEENHNLRCQHHQMMLERRELLAKNEQARSRVE AMITRLKTLEQHT NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggatcagcctgatgccctcaccgaactccactctctagcagcgcagctagagaggctg atcgaatactgtcaacgtttagctgaggaaaatcacaatttgcgctgccagcatcatcag atgatgcttgaacgtcgcgaacttctagcaaaaaacgaacaagcacgctcgcgcgttgaa gcaatgattacacgtcttaagaccctggagcagcacacgtga

DBGET integrated database retrieval system