Xylella fastidiosa M23: XfasM23_1975 Help Entry XfasM23_1975      CDS       T00692                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism xfn  Xylella fastidiosa M23 Brite KEGG Orthology (KO) [BR:xfn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xfn03036]     XfasM23_1975 Chromosome and associated proteins [BR:xfn03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     XfasM23_1975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC CLLAC Motif Other DBs NCBI-ProteinID:  ACB93374 UniProt:  B2I9B9 LinkDB All DBs Position complement(2217147..2217410) Genome browser AA seq 87 aa AA seqDB search MSRLLLIILLACTVASAIGVVYMRHLHRKLFVELSHAERVRDDLNIEFGRLQLEQATWAE ANRVDQVARERLGMRFPESKEIVVVRP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccgtctgctgttgattattcttttggcttgtacggtcgcttcggcgatcggtgtg gtttacatgcgccatctgcatcgaaagttattcgttgagctgtcccatgccgagcgggta cgtgatgatctgaatattgagtttggtcgattgcagttggagcaagcgacgtgggccgaa gccaatcgggttgatcaggttgcacgtgagcgcttagggatgagattcccggaaagcaaa gagatcgttgtggtgcgtccatga

DBGET integrated database retrieval system