Xanthomonas fragariae: BER92_01685 Help Entry BER92_01685       CDS       T04667                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xfr  Xanthomonas fragariae Pathway xfr01100   Metabolic pathways xfr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xfr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BER92_01685    00074 Mycolic acid biosynthesis     BER92_01685   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BER92_01685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOD13674 UniProt:  A0A1Y6HBH7 LinkDB All DBs Position 367354..367623 Genome browser AA seq 89 aa AA seqDB search MSSQTAAERELAELLVESLNVEDVQPADIDPEAPLFNTGLGLDSIDALELALAISKRYGF QLRSDTDENRRIFASLRALSAHVQAHKTV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcctcgcaaaccgccgccgaacgtgaactggccgaactcctggtcgaaagtctgaac gtggaagacgtccagcctgccgacatcgatccggaggccccgctgttcaataccgggttg gggctcgactcgatcgacgcgctggaactggccctggcgatcagcaagcgctacggcttc cagctgcgctcggacactgatgaaaatcgtcgtatcttcgcgtcgctgcgcgcattgtcg gcgcatgtccaagcccacaagaccgtctga

DBGET integrated database retrieval system