Xanthomonas fragariae: BER92_14000 Help Entry BER92_14000       CDS       T04667                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xfr  Xanthomonas fragariae Pathway xfr01100   Metabolic pathways xfr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xfr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BER92_14000    00074 Mycolic acid biosynthesis     BER92_14000   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BER92_14000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  AOD15623 UniProt:  A0A1Y6H499 LinkDB All DBs Position complement(3064363..3064602) Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgttgaacaactcggcgtcaaggaa gaggaagtcaccaccagcgcatcgttcgtcgatgacttaggggccgactcgctggacacc gtcgagctggtgatggcactggaagaagagttcgagtgcgagatcccggacgaagaggcc gagaagatcacctcggtccagcaggcgatagactacgtcaaggcgcacgtcaagagttga

DBGET integrated database retrieval system