Xylella fastidiosa subsp. sandyi Ann-1: D934_11600 Help Entry D934_11600        CDS       T03318                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xfs  Xylella fastidiosa subsp. sandyi Ann-1 Pathway xfs01100   Metabolic pathways xfs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xfs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D934_11600    00074 Mycolic acid biosynthesis     D934_11600   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D934_11600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB Motif Other DBs NCBI-ProteinID:  AIC10601 UniProt:  A0A060HB49 LinkDB All DBs Position complement(2326885..2327124) Genome browser AA seq 79 aa AA seqDB search MSDIEARVRKIVAEKLNVDEEKVTNTSTFVDELGADSLDTVELVMALEDEFQCEIGDEAA EKMTSVQHAIDYIKSNAKC NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacatcgaagcgcgcgtcagaaaaattgtcgccgagaaactcaatgtcgatgaa gaaaaagtaactaatacctcgacgttcgtcgatgaactgggtgcggattcgttggatacc gtcgagttggtgatggccttggaagacgagttccaatgtgagatcggtgacgaggctgct gagaagatgacttcggtgcaacatgctatcgactacattaagagtaatgctaagtgctaa

DBGET integrated database retrieval system