Xylella fastidiosa subsp. sandyi Ann-1: D934_13205 Help Entry D934_13205        CDS       T03318                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism xfs  Xylella fastidiosa subsp. sandyi Ann-1 Brite KEGG Orthology (KO) [BR:xfs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xfs03036]     D934_13205 Chromosome and associated proteins [BR:xfs03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     D934_13205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC CLLAC Motif Other DBs NCBI-ProteinID:  AIC10811 UniProt:  A0A060HBR6 LinkDB All DBs Position complement(2642582..2642845) Genome browser AA seq 87 aa AA seqDB search MSRLLLIILLACTVASAIGVVYMRHLHRKLFVELSHAERVRDDLNIEFGRLQLEQATWAE ANRVDQVARERLGMRFPESKEIVVVRP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccgtctgctgttgattattcttttggcttgtacggtcgcttcggcgattggtgtg gtttacatgcgccatctgcatcgaaagttattcgttgagctgtcccatgccgagcgggtg cgtgatgatctgaatattgagtttggtcgattgcagttggagcaagcgacgtgggccgaa gccaatcgggttgatcaggttgcacgtgagcgcttagggatgagattcccggaaagcaaa gagatcgttgtggtgcgtccatga

DBGET integrated database retrieval system