Xylella fastidiosa Temecula1: PD_0719 Help Entry PD_0719           CDS       T00113                                  Symbol rpoZ Name (GenBank) RNA polymerase omega subunit   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism xft  Xylella fastidiosa Temecula1 Pathway xft03020   RNA polymerase Brite KEGG Orthology (KO) [BR:xft00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PD_0719 (rpoZ)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:xft03021]     PD_0719 (rpoZ)    03400 DNA repair and recombination proteins [BR:xft03400]     PD_0719 (rpoZ) Enzymes [BR:xft01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      PD_0719 (rpoZ) Transcription machinery [BR:xft03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      PD_0719 (rpoZ) DNA repair and recombination proteins [BR:xft03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       PD_0719 (rpoZ) SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  AAO28588 UniProt:  Q87DG6 LinkDB All DBs Position complement(883270..883569) Genome browser AA seq 99 aa AA seqDB search MARITVEDCLEVVNNRFELVMMASKRARQLANGVPPLIENTNSEDKPTVMALREIAARKI NSKMIDEIEKAERERAEREAMEWAAAEVVADEDMSKSDD NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcacgtatcactgttgaagattgcctggaagttgttaacaaccgtttcgaactggtc atgatggcatccaaacgtgcccgtcagctcgctaacggtgtaccgccgctcattgaaaat accaatagcgaagataagccgaccgtaatggcattacgtgaaattgctgcacgcaagatc aacagtaagatgatcgacgagatcgagaaggccgaacgcgagcgggctgagcgtgaagct atggaatgggccgccgctgaagtcgtcgctgacgaagatatgtctaaaagcgacgattga

DBGET integrated database retrieval system