Xylella fastidiosa Temecula1: PD_1872 Help Entry PD_1872           CDS       T00113                                  Symbol ftsL Name (GenBank) cell division protein   KO K03586   cell division protein FtsL Organism xft  Xylella fastidiosa Temecula1 Brite KEGG Orthology (KO) [BR:xft00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xft03036]     PD_1872 (ftsL) Chromosome and associated proteins [BR:xft03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PD_1872 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC CLLAC Motif Other DBs NCBI-ProteinID:  AAO29704 UniProt:  Q87AF3 LinkDB All DBs Position complement(2201322..2201585) Genome browser AA seq 87 aa AA seqDB search MSRLLLIILLACTVASAIGVVYMRHLHRKLFVELSHAERVRDDLNIEFGRLQLEQATWAE ANRVDQVARERLGMRFPESKEIVVVRP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccgtctgctgttgattattcttttggcttgtacggtcgcttcggcgatcggtgtg gtttacatgcgccatctgcatcgaaagttattcgttgagctgtcccatgccgagcgggta cgtgatgatctgaatattgagtttggtcgattgcagttggagcaagcgacgtgggccgaa gccaatcgggttgatcaggttgcacgtgagcgcttagggatgagattcccggaaagcaaa gagatcgttgtggtgcgtccatga

DBGET integrated database retrieval system