Xiphias gladius (swordfish): 120784131 Help Entry 120784131         CDS       T07311                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism xgl  Xiphias gladius (swordfish) Pathway xgl04010   MAPK signaling pathway xgl04144   Endocytosis xgl04370   VEGF signaling pathway xgl04510   Focal adhesion xgl04520   Adherens junction xgl04530   Tight junction xgl04810   Regulation of actin cytoskeleton xgl04912   GnRH signaling pathway xgl05100   Bacterial invasion of epithelial cells xgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120784131 (cdc42l)    04370 VEGF signaling pathway     120784131 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120784131 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120784131 (cdc42l)    04520 Adherens junction     120784131 (cdc42l)    04530 Tight junction     120784131 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120784131 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     120784131 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120784131 (cdc42l)    05100 Bacterial invasion of epithelial cells     120784131 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xgl04131]     120784131 (cdc42l)    03036 Chromosome and associated proteins [BR:xgl03036]     120784131 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xgl04147]     120784131 (cdc42l)    04031 GTP-binding proteins [BR:xgl04031]     120784131 (cdc42l) Membrane trafficking [BR:xgl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     120784131 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     120784131 (cdc42l)   Macropinocytosis    Ras GTPases     120784131 (cdc42l) Chromosome and associated proteins [BR:xgl03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     120784131 (cdc42l) Exosome [BR:xgl04147]  Exosomal proteins   Exosomal proteins of microglial cells    120784131 (cdc42l)   Exosomal proteins of breast milk    120784131 (cdc42l) GTP-binding proteins [BR:xgl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     120784131 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  120784131 NCBI-ProteinID:  XP_039973574 LinkDB All DBs Position LG22:complement(19310777..19316075) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR EDSNTVEKLAKNKQRPLYPESGEKLARELKAVKYVECSALTQRGLKNVFDEAILAALEPP ETKAKRKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaaatgtgtagtggtaggagacggtgcagtaggaaagacctgcttacta atctcctacacaaccaacaagttcccctcagaatatgtgcctacggtttttgacaattat gcagtgacagtgatgatcgggggagagccctacacactcggcctttttgacacagccggt caggaggattatgacaggctgcgtcctctcagctatccacagacagacgtgttcctcgtg tgtttttctgtcgtctccccctcatcttttgaaaacgtcaaagagaagtgggttcctgag atttcacaccactgcccacgcacacccttcctgttagtgggcacacaagtggacctgcgg gaagacagcaacacggtggagaagctggcaaagaacaaacagcgccccctatatcccgag agtggagagaaactggcgcgtgagctcaaggctgtcaaatatgtggagtgctctgctctg acacagcgagggcttaagaatgtgttcgacgaggccatcctggcagccttggagccccca gagaccaaagccaagagaaagtgcgttctgctatag

DBGET integrated database retrieval system