Xiphias gladius (swordfish): 120784256 Help Entry 120784256         CDS       T07311                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism xgl  Xiphias gladius (swordfish) Pathway xgl04382   Cornified envelope formation xgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xgl00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     120784256 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120784256 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xgl04147]     120784256 (s100a10b) Exosome [BR:xgl04147]  Exosomal proteins   Exosomal proteins of microglial cells    120784256 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  120784256 NCBI-ProteinID:  XP_039973811 LinkDB All DBs Position LG22:17548681..17550361 Genome browser AA seq 98 aa AA seqDB search MTDLEKSMESLIEVFHRYAGQDSDGKTLSKKELKKLIENELPSFLACQKNPNVVDCIMKD LDQNKDDKLDFEEFIPLVVGLSMACEKCYVLHAQKGKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgactgatttggagaaaagcatggagtccctgattgaggttttccaccgctatgccggt caagacagcgatgggaagaccttaagcaagaaagaactgaaaaaactcattgagaatgag ttaccctccttcttggcatgccagaaaaaccccaatgtcgtggactgcatcatgaaagat ttggaccaaaacaaagatgataagttggactttgaagaattcattcccctcgttgtcggt ctctcaatggcctgtgagaagtgttacgtgctccatgcacagaagggcaagaagtga

DBGET integrated database retrieval system