Xiphias gladius (swordfish): 120785499 Help Entry 120785499         CDS       T07311                                  Symbol insb Name (RefSeq) preproinsulin b   KO K04526   insulin Organism xgl  Xiphias gladius (swordfish) Pathway xgl04010   MAPK signaling pathway xgl04068   FoxO signaling pathway xgl04081   Hormone signaling xgl04114   Oocyte meiosis xgl04140   Autophagy - animal xgl04150   mTOR signaling pathway xgl04810   Regulation of actin cytoskeleton xgl04910   Insulin signaling pathway xgl04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:xgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120785499 (insb)    04068 FoxO signaling pathway     120785499 (insb)    04150 mTOR signaling pathway     120785499 (insb)   09133 Signaling molecules and interaction    04081 Hormone signaling     120785499 (insb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120785499 (insb)   09143 Cell growth and death    04114 Oocyte meiosis     120785499 (insb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120785499 (insb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     120785499 (insb)    04914 Progesterone-mediated oocyte maturation     120785499 (insb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:xgl04052]     120785499 (insb) Cytokines and neuropeptides [BR:xgl04052]  Neuropeptides   Unclassified    120785499 (insb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  120785499 NCBI-ProteinID:  XP_039976201 LinkDB All DBs Position LG23:complement(20882063..20884753) Genome browser AA seq 111 aa AA seqDB search MARVPWAVSVMLLLVLYSHGVSSAPIQHLCGSHLVDALYFVCGERGFFYSPNRHQKRDLE HLLGFLSKRARREQRLWRALSDRDEPKVKRGIVEQCCHTPCSIYHLEGYCD NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagggtaccttgggcagtgtccgtaatgctactgctggtgctctactcccatggg gtgtcctcggcccccatccagcacctgtgtggctcccacctggtggacgccctctacttc gtatgtggagaacggggctttttctacagtccaaaccgacaccaaaagcgggatctggaa catctgctcgggttcctgtctaaaagggccagacgggagcagcggctgtggagggctctg tctgaccgtgatgagcccaaggtgaagagaggcatcgtggagcagtgctgccatacgccg tgcagcatttaccacctagagggctactgcgactga

DBGET integrated database retrieval system