Xiphias gladius (swordfish): 120789131 Help Entry 120789131         CDS       T07311                                  Name (RefSeq) mitoregulin-like   KO K29035   mitoregulin Organism xgl  Xiphias gladius (swordfish) Brite KEGG Orthology (KO) [BR:xgl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:xgl03029]     120789131 Mitochondrial biogenesis [BR:xgl03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     120789131 SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom Motif Other DBs NCBI-GeneID:  120789131 NCBI-ProteinID:  XP_039981580 LinkDB All DBs Position LG4 Genome browser AA seq 56 aa AA seqDB search MADVSERTLQVAVVVSFAAGFLAGWQANRMRRKFLDWRKKRLQDKLSETQKKLDLA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggcagacgtctcggagaggacgctacaagtcgccgtcgtggtctctttcgccgccggc ttcctggcgggctggcaggccaaccgaatgaggaggaagtttctggactggaggaagaag cggctgcaagacaaactgtcagaaacacagaagaagctggacttggcgtga

DBGET integrated database retrieval system