Xiphias gladius (swordfish): 120791497 Help Entry 120791497         CDS       T07311                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism xgl  Xiphias gladius (swordfish) Pathway xgl04814   Motor proteins xgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xgl00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     120791497 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120791497 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:xgl03037]     120791497 (dynll2a)    04812 Cytoskeleton proteins [BR:xgl04812]     120791497 (dynll2a) Cilium and associated proteins [BR:xgl03037]  Motile cilia and associated proteins   Dynein arm    120791497 (dynll2a) Cytoskeleton proteins [BR:xgl04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      120791497 (dynll2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  120791497 NCBI-ProteinID:  XP_039985835 LinkDB All DBs Position LG7:20287956..20291898 Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgacggacaggaaagccgtgatcaagaacgccgacatgtccgaggacatgcagcaggac gccgtggactgtgccacccaggccatggagaagtacaacatagagaaggacatcgcggct tacatcaagaaggagtttgacaagaagtacaaccccacctggcactgcatcgtcgggagg aacttcggcagctacgtcacccacgagacaaagcatttcatttacttctacttgggccaa gtggccatcttgctcttcaagtctggctga

DBGET integrated database retrieval system