Xiphias gladius (swordfish): 120792406 Help Entry 120792406         CDS       T07311                                  Symbol hmgb1b Name (RefSeq) high mobility group protein B1b   KO K10802   high mobility group protein B1 Organism xgl  Xiphias gladius (swordfish) Pathway xgl03410   Base excision repair xgl04140   Autophagy - animal xgl04217   Necroptosis Brite KEGG Orthology (KO) [BR:xgl00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     120792406 (hmgb1b)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120792406 (hmgb1b)   09143 Cell growth and death    04217 Necroptosis     120792406 (hmgb1b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xgl03036]     120792406 (hmgb1b)    03400 DNA repair and recombination proteins [BR:xgl03400]     120792406 (hmgb1b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xgl04147]     120792406 (hmgb1b) Chromosome and associated proteins [BR:xgl03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     120792406 (hmgb1b) DNA repair and recombination proteins [BR:xgl03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      120792406 (hmgb1b)    MMR (mismatch excision repair)     Other MMR factors      120792406 (hmgb1b) Exosome [BR:xgl04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120792406 (hmgb1b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 HMG_box_5 DUF2921 Motif Other DBs NCBI-GeneID:  120792406 NCBI-ProteinID:  XP_039987505 LinkDB All DBs Position LG7:complement(21659172..21662323) Genome browser AA seq 197 aa AA seqDB search MVKDPKKPRGKMSSYAYFVQTCREEHKKKHPDASVNFAEFSKKCSERWKTMSPKEKGKFE DMAKQDKVRYEREMKNYIPPKGQKKKRFKDPNAPKRPPSAFFLFCADFRPKVKGESPGLS IGDTAKKLGEMWNSSSAEDKQPYEKKAAKLKEKYDKDIVAYRTKGKVDSGSAATADDDDE EEEGDEEEDEDEDDDDE NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atggtgaaggatccaaagaagccaaggggcaaaatgtcctcatatgcctattttgtgcaa acgtgccgagaggaacataagaagaaacatcctgatgcttctgtcaactttgcagagttc tccaagaaatgctctgagcgatggaagacaatgtcaccaaaagaaaaaggcaagtttgaa gatatggccaaacaagacaaggtgcgttatgagagggaaatgaagaattatattcccccc aaaggccagaagaagaagcgatttaaggaccccaacgcccccaagagaccaccgtctgca ttcttcctattctgtgcagactttcgccccaaggtaaaaggtgaaagccccggactctcc atcggggacacggcaaagaagttgggagagatgtggaacagctcatctgcagaggacaag cagccgtatgagaagaaggctgccaagttgaaggagaaatacgacaaggatatcgttgct taccgcacgaagggcaaggtggattcaggatcggctgctacagcggacgatgatgatgag gaagaggaaggagacgaggaggaggacgaagacgaggatgacgacgacgagtag

DBGET integrated database retrieval system