Xiphias gladius (swordfish): 120792735 Help Entry 120792735         CDS       T07311                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism xgl  Xiphias gladius (swordfish) Pathway xgl04010   MAPK signaling pathway xgl04012   ErbB signaling pathway xgl04068   FoxO signaling pathway xgl04137   Mitophagy - animal xgl04140   Autophagy - animal xgl04144   Endocytosis xgl04150   mTOR signaling pathway xgl04210   Apoptosis xgl04218   Cellular senescence xgl04370   VEGF signaling pathway xgl04371   Apelin signaling pathway xgl04510   Focal adhesion xgl04519   Cadherin signaling xgl04540   Gap junction xgl04625   C-type lectin receptor signaling pathway xgl04810   Regulation of actin cytoskeleton xgl04910   Insulin signaling pathway xgl04912   GnRH signaling pathway xgl04916   Melanogenesis xgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120792735    04012 ErbB signaling pathway     120792735    04370 VEGF signaling pathway     120792735    04371 Apelin signaling pathway     120792735    04068 FoxO signaling pathway     120792735    04150 mTOR signaling pathway     120792735   09133 Signaling molecules and interaction    04519 Cadherin signaling     120792735  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120792735    04140 Autophagy - animal     120792735    04137 Mitophagy - animal     120792735   09143 Cell growth and death    04210 Apoptosis     120792735    04218 Cellular senescence     120792735   09144 Cellular community - eukaryotes    04510 Focal adhesion     120792735    04540 Gap junction     120792735   09142 Cell motility    04810 Regulation of actin cytoskeleton     120792735  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120792735   09152 Endocrine system    04910 Insulin signaling pathway     120792735    04912 GnRH signaling pathway     120792735    04916 Melanogenesis     120792735  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120792735  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xgl04131]     120792735   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xgl04147]     120792735    04031 GTP-binding proteins [BR:xgl04031]     120792735 Membrane trafficking [BR:xgl04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     120792735  Endocytosis   Macropinocytosis    Ras GTPases     120792735 Exosome [BR:xgl04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    120792735   Exosomal proteins of colorectal cancer cells    120792735 GTP-binding proteins [BR:xgl04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120792735 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  120792735 NCBI-ProteinID:  XP_039987975 LinkDB All DBs Position LG8 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggtgggagctggaggcgtgggcaagagtgcactcacc attcagctcatccagaaccactttgtggatgaatatgaccccaccatagaggactcgtac aggaaacaagttgtgattgacggggagacctgcttgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggtttcctgtgc gtctttgccatcaacaacaccaagtcttttgaggacattcaccagtacagagaacaaatt aaacgtgtaaaggactcagacgatgtccccatggtgctcgtgggaaacaaatgtgacctc ccggcacgcacggtggacacaaggcaagcccaggaactcgcccgctcctatggaatccct tacattgagacctctgccaagacacgacagggagtggaggatgccttctacacactggtc agggagatcagacagcataaactgaggaagctgaacccacctgatgagagcggtcaggat tgtatgagctgtcgctgtgtggtatcatga

DBGET integrated database retrieval system