Xiphias gladius (swordfish): 120795148 Help Entry 120795148         CDS       T07311                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism xgl  Xiphias gladius (swordfish) Pathway xgl04020   Calcium signaling pathway xgl04070   Phosphatidylinositol signaling system xgl04114   Oocyte meiosis xgl04218   Cellular senescence xgl04261   Adrenergic signaling in cardiomyocytes xgl04270   Vascular smooth muscle contraction xgl04371   Apelin signaling pathway xgl04625   C-type lectin receptor signaling pathway xgl04744   Phototransduction xgl04910   Insulin signaling pathway xgl04912   GnRH signaling pathway xgl04916   Melanogenesis Brite KEGG Orthology (KO) [BR:xgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     120795148    04020 Calcium signaling pathway     120795148    04070 Phosphatidylinositol signaling system     120795148  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     120795148    04218 Cellular senescence     120795148  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120795148   09152 Endocrine system    04910 Insulin signaling pathway     120795148    04912 GnRH signaling pathway     120795148    04916 Melanogenesis     120795148   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     120795148    04270 Vascular smooth muscle contraction     120795148   09157 Sensory system    04744 Phototransduction     120795148  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:xgl01009]     120795148   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xgl04131]     120795148    03036 Chromosome and associated proteins [BR:xgl03036]     120795148   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xgl04147]     120795148 Protein phosphatases and associated proteins [BR:xgl01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      120795148 Membrane trafficking [BR:xgl04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     120795148 Chromosome and associated proteins [BR:xgl03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      120795148 Exosome [BR:xgl04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120795148 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_5 EH EF-hand_11 p25-alpha GPHH FlgD Motif Other DBs NCBI-GeneID:  120795148 NCBI-ProteinID:  XP_039992691 LinkDB All DBs Position LG1:complement(27771301..27778007) Genome browser AA seq 153 aa AA seqDB search MAKFFTPVQINEFKECFSLYDKNQKGKIVAKDLITVMRCLGTSPTFGEIERHLQVHKIEK TGELDFSSFLTMMHRQIQQEDPKAEILEALRMTDKQKKGYIQASELRAKLTMLGEKLTDK EVDELFRETNVKSNGTVNYEEFTRMVTLPPVDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggccaaatttttcacaccagttcaaatcaatgagttcaaggagtgcttctccttgtat gacaagaaccaaaagggcaagattgttgccaaagatctgatcacagttatgcgctgcctg ggtacaagccccacattcggtgagattgaaagacatctgcaagttcacaaaattgaaaag acaggtgagctggatttctcttcgttcctgacaatgatgcacaggcagatacaacaggaa gatcccaaggcagaaatcctggaggcgttgaggatgacagacaagcagaagaaaggatac atccaagcatctgagctccgagccaagctcaccatgttaggagagaagctcacagacaaa gaagtggatgagctcttcagagagacaaacgtcaagtcaaacggtactgtcaactatgaa gagttcacccggatggtgacgctgccacctgttgattactga

DBGET integrated database retrieval system