Xiphias gladius (swordfish): 120797365 Help Entry 120797365         CDS       T07311                                  Symbol txn Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism xgl  Xiphias gladius (swordfish) Pathway xgl04621   NOD-like receptor signaling pathway xgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xgl00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120797365 (txn)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120797365 (txn)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:xgl03110]     120797365 (txn) Chaperones and folding catalysts [BR:xgl03110]  Protein folding catalysts   Protein disulfide isomerase    120797365 (txn) SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 AhpC-TSA Thioredoxin_7 OST3_OST6 Thioredoxin_8 Redoxin Thioredoxin_9 DIM1 A6-like_Thioredoxin-like_C PedC-like Motif Other DBs NCBI-GeneID:  120797365 NCBI-ProteinID:  XP_039996890 LinkDB All DBs Position LG12 Genome browser AA seq 108 aa AA seqDB search MVRQVENLEEFMAILKEAGDKLVVVDFTATWCGPCKQIAPQFVALSEKPENKNVIFLKVD VDEAEDLSSHCDINCMPTFQFYRKGERVSEFSGANIDKLKSLLESLRQ NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggttcgccaagtggaaaatttggaggagttcatggccatcctgaaggaggccggagac aagctggtggtggtggacttcacagccacgtggtgtggcccctgtaaacagatcgcccca caatttgtagcactgtcagaaaagcctgagaacaagaacgtaatattcctgaaggtggat gtggatgaggctgaggatttgagttcacactgtgatattaactgcatgcccacattccaa ttctacaggaaaggagagagggtttccgaattctctggtgctaacatagacaagttgaaa tcgttactggaatctctgagacaataa

DBGET integrated database retrieval system